PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00058.116
Common NameAMTR_s00058p00148530, LOC18434788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 158aa    MW: 17944.5 Da    PI: 8.361
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00058.116genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.41e-3771061100
                                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                               +C aCk+lrr+C+ +C+lapyfp+++p+kf +vhk+FGasn+++ lk+++ +er+d+++s+vyeA ar+
  evm_27.model.AmTr_v1.0_scaffold00058.116   7 SCGACKILRRRCNGSCFLAPYFPSSDPNKFFVVHKVFGASNLIRHLKEVDVKERDDVVKSMVYEATARL 75 
                                               6******************************************************************** PP

                                    DUF260  70 rdPvyGavgvilklqqqleqlkaelallkee 100
                                                dPvyG++g i++l +q + l+++la++ ee
  evm_27.model.AmTr_v1.0_scaffold00058.116  76 TDPVYGCTGAIFSLLKQANDLRSQLAKAMEE 106
                                               *************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4426107IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-377103IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:3.20.20.2106.0E-533125No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MKKSRTSCGA CKILRRRCNG SCFLAPYFPS SDPNKFFVVH KVFGASNLIR HLKEVDVKER  60
DDVVKSMVYE ATARLTDPVY GCTGAIFSLL KQANDLRSQL AKAMEEIAEI QEQCRHLMAI  120
LTDDTNWYSF QVYSDDNISY LNNNNNVSKW LMKVETS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844914.11e-117PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR08e-45LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW1PFW01e-117W1PFW0_AMBTC; Uncharacterized protein
STRINGPOPTR_0008s04350.13e-43(Populus trichocarpa)
STRINGSolyc06g005090.2.12e-43(Solanum lycopersicum)
STRINGPGSC0003DMT4000194102e-43(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-40LOB domain-containing protein 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]